PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT08945
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Dof
Protein Properties Length: 630aa    MW: 68204.3 Da    PI: 5.1595
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT08945genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22.1e-39248307261
    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
               ++k+++cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+s
  EMT08945 248 PDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGSMRNVPVGAGRRKSKNS 307
               7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30245305IPR003851Zinc finger, Dof-type
PfamPF027011.2E-31250306IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.761252306IPR003851Zinc finger, Dof-type
PROSITE patternPS013610254290IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MRWRLWAPPY LPEGRRIYPF PTALCVPGET LGLVRAAVAS SSHSFLKVMP VAIAEAAAAR  60
DRSLPGPRVG SRMSDQMDSG IKLFGRVIPL VPDAAPGPPE AEATAGSEHP PPPPPASEAE  120
PEADNNKEMA YHMLPTYRWL SEDTTELEQH KEMEDKGDSE MKVDAPEEKE DSATKGDEPR  180
ERKDNEMEVD APQAKENAET ASSSTLDHKK DDQAQISNTE EKAASDPKEG NEKKSNDESG  240
QDKVLKKPDK IIPCPRCNSM DTKFCYYNNY NVNQPRHFCK NCQRYWTAGG SMRNVPVGAG  300
RRKSKNSALH YRQLLMAPDC LLGSRVDISN TVNPEVLASL PSIPTQSASR SETVLKFGPE  360
VPLCESMVSV LNIEEQNVTN AGSVPRDETR EDNSCASSTT SNNGLPANAV LPGQNGAPAY  420
CNGVGPVPQY YLGAPFMYPW SMGWNNLPVM VPGGSMPESA SPSESCSTSS APWMNSPMMP  480
GSRLPAPPFP YPLVPPALWG CLPSWPAAAW NTPWVGTNGC ISPSGSSNSS CSGNGSPTLG  540
KHSRDPNPQK DDKEEKSLWV PKTLRIDDPD EAAKSSIWAT LGIKPGDPGV FKPFQFKGES  600
KGQPADARPA RALQANPAAF SRLQSFQESS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565622.20.0PREDICTED: cyclic dof factor 2-like
TrEMBLM8B5R40.0M8B5R4_AEGTA; Dof zinc finger protein
STRINGMLOC_56598.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-66cycling DOF factor 2